| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein farnesyltransferase subunit beta/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Ligand | BDBM50101929 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_70446 |
|---|
| IC50 | 0.100000±n/a nM |
|---|
| Citation |  Beshore, DC; Bell, IM; Dinsmore, CJ; Homnick, CF; Culberson, JC; Robinson, RG; Fernandes, C; Walsh, ES; Abrams, MT; Bhimnathwala, HG; Davide, JP; Ellis-Hutchings, MS; Huber, HA; Koblan, KS; Buser, CA; Kohl, NE; Lobell, RB; Chen, IW; McLoughlin, DA; Olah, TV; Graham, SL; Hartman, GD; Williams, TM Evaluation of amino acid-based linkers in potent macrocyclic inhibitors of farnesyl-protein transferase. Bioorg Med Chem Lett11:1817-21 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein farnesyltransferase subunit beta/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Name: | Protein farnesyltransferase subunit beta/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Synonyms: | Farnesyltransferase (FTase) | Protein Farnesyltransferase (PFT) | Protein Farnesyltransferase (PFT) Chain B | Protein farnesyltransferase |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | To express recombinant enzyme in E. coli, the cloned human alpha and beta subunits were co-expressed from a plasmid, in which their expression was translationally coupled. |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Protein farnesyltransferase subunit beta |
|---|
| Synonyms: | CAAX farnesyltransferase subunit alpha | CAAX farnesyltransferase subunit beta | FNTB | FNTB_HUMAN | FTase-alpha | FTase-beta | GGTase-I-alpha | Protein Farnesyltransferase (PFT) Chain B | Protein farnesyl/geranylgeranyl transferase | Protein farnesyltransferase beta subunit | Protein farnesyltransferase subunit beta | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha | Ras proteins prenyltransferase subunit alpha | Ras proteins prenyltransferase subunit beta | Type I protein geranyl-geranyltransferase subunit alpha |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 48766.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Protein farnesyltransferase subunit beta |
|---|
| Residue: | 437 |
|---|
| Sequence: | MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQY
LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF
YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV
PGFEELKDETSAEPATD
|
|
|
|---|
| Component 2 |
| Name: | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha |
|---|
| Synonyms: | CAAX farnesyltransferase alpha subunit | FNTA | FNTA_HUMAN | FTase-1-alpha | FTase-alpha | GGTase-I-alpha | Geranylgeranyl Transferase (GGTase-I) Chain A | Geranylgeranyl transferase type I | Protein Farnesyltransferase (PFT) Chain A | Protein farnesyl/geranylgeranyl transferase | Protein farnesyltransferase | Protein farnesyltransferase subunit alpha | Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit | Ras proteins prenyltransferase alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44392.46 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Recombinant human FTase. |
|---|
| Residue: | 379 |
|---|
| Sequence: | MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ
|
|
|
|---|
| BDBM50101929 |
|---|
| n/a |
|---|
| Name | BDBM50101929 |
|---|
| Synonyms: | 3-oxo-18-oxa-2,5,9,11-tetraazahexacyclo[17.6.2.22,5.113,17.07,11.022,26]triaconta-1(26),7,9,13(30),14,16,19(27),20,22,24-decaen-16-yl cyanide | 3-oxo-18-oxa-2,5,9,11-tetraazahexacyclo[17.6.2.22,5.113,17.07,11.022,26]triaconta-1(26),7,9,13,15,17(30),19(27),20,22,24-decaen-16-yl cyanide | 4-{5-[4-(3-Chloro-phenyl)-3-oxo-piperazin-1-ylmethyl]-imidazol-1-ylmethyl}-benzonitrile | CHEMBL52073 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21N5O2 |
|---|
| Mol. Mass. | 435.4772 |
|---|
| SMILES | O=C1CN2CCN1c1cccc3ccc(Oc4cc(Cn5cncc5C2)ccc4C#N)cc13 |
|---|
| Structure | 
|
|---|
Search and Browse
