Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50103084
Substrate/Competitorn/a
Meas. Tech.ChEBML_39649
Ki 44±n/a nM
Citation Tagat JRMcCombie SWSteensma RWLin SNazareno DVBaroudy BVantuno NXu SLiu J Piperazine-based CCR5 antagonists as HIV-1 inhibitors. I: 2(S)-methyl piperazine as a key pharmacophore element. Bioorg Med Chem Lett 11:2143-6 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:CCR5/mu opioid receptor complex
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CCR5/mu opioid receptor complex | CD_antigen=CD195 | CHEMR13 | HIV-1 fusion coreceptor
Type:Enzyme
Mol. Mass.:40540.21
Organism:Homo sapiens (Human)
Description:P51681
Residue:352
Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103084
n/a
NameBDBM50103084
Synonyms:CHEMBL66623 | {4-[(S)-4-(4-Benzo[1,3]dioxol-5-ylmethyl-benzyl)-3-methyl-piperazin-1-yl]-piperidin-1-yl}-(2,6-dimethyl-phenyl)-methanone
TypeSmall organic molecule
Emp. Form.C34H41N3O3
Mol. Mass.539.7076
SMILESC[C@H]1CN(CCN1Cc1ccc(Cc2ccc3OCOc3c2)cc1)C1CCN(CC1)C(=O)c1c(C)cccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: