Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50103098
Substrate/Competitorn/a
Meas. Tech.ChEBML_105542
Ki 34±n/a nM
Citation Musso DLAndersen MWAndrews RCAustin RBeaudet EJBecherer JDBubacz DGBickett DMChan JHConway JGCowan DJGaul MDGlennon KCHedeen KMLambert MHLeesnitzer MAMcDougald DLMitchell JLMoss MLRabinowitz MHRizzolio MCSchaller LTStanford JBTippin TWarner JRWhitesell LGWiethe RW N-hydroxyformamide peptidomimetics as TACE/matrix metalloprotease inhibitors: oral activity via P1' isobutyl substitution. Bioorg Med Chem Lett 11:2147-51 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase 2/9
Synonyms:67 kDa matrix metalloproteinase-9 | 82 kDa matrix metalloproteinase-9 | 92 kDa gelatinase | 92 kDa type IV collagenase | GELB | Gelatinase B | MMP-9 | Matrix metalloproteinase 9 (MMP-9) | Matrix metalloproteinase-9 | Matrix metalloproteinase-9 (MMP-9) | Matrix metalloproteinase-9 (MMP9)
Type:Enzyme
Mol. Mass.:78452.28
Organism:Homo sapiens (Human)
Description:P14780
Residue:707
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103098
n/a
NameBDBM50103098
Synonyms:(R)-2-[(S)-1-(Formyl-hydroxy-amino)-ethyl]-4-methyl-pentanoic acid [2,2-dimethyl-1-(thiazol-2-ylcarbamoyl)-propyl]-amide | CHEMBL68553
TypeSmall organic molecule
Emp. Form.C18H30N4O4S
Mol. Mass.398.52
SMILESCC(C)C[C@H]([C@H](C)N(O)C=O)C(=O)N[C@H](C(=O)Nc1nccs1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: