Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterstitial collagenase
LigandBDBM50103102
Substrate/Competitorn/a
Meas. Tech.ChEBML_105944
Ki 36±n/a nM
Citation Musso DLAndersen MWAndrews RCAustin RBeaudet EJBecherer JDBubacz DGBickett DMChan JHConway JGCowan DJGaul MDGlennon KCHedeen KMLambert MHLeesnitzer MAMcDougald DLMitchell JLMoss MLRabinowitz MHRizzolio MCSchaller LTStanford JBTippin TWarner JRWhitesell LGWiethe RW N-hydroxyformamide peptidomimetics as TACE/matrix metalloprotease inhibitors: oral activity via P1' isobutyl substitution. Bioorg Med Chem Lett 11:2147-51 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Interstitial collagenase
Name:Interstitial collagenase
Synonyms:Fibroblast collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103102
n/a
NameBDBM50103102
Synonyms:(R)-2-[(S)-1-(Formyl-hydroxy-amino)-ethyl]-4-methyl-pentanoic acid [2-methyl-1-(thiazol-2-ylcarbamoyl)-propyl]-amide | CHEMBL302941
TypeSmall organic molecule
Emp. Form.C17H28N4O4S
Mol. Mass.384.494
SMILESCC(C)C[C@H]([C@H](C)N(O)C=O)C(=O)N[C@@H](C(C)C)C(=O)Nc1nccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: