Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRA
LigandBDBM50105011
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63352
IC50 0.56±n/a nM
Citation Morimoto HShimadzu HKushiyama EKawanishi HHosaka TKawase YYasuda KKikkawa KYamauchi-Kohno RYamada K Potent and selective ET-A antagonists. 1. Syntheses and structure-activity relationships of N-(6-(2-(aryloxy)ethoxy)-4-pyrimidinyl)sulfonamide derivatives. J Med Chem 44:3355-68 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
EDNRA
Name:Endothelin receptor
Synonyms:ENDOTHELIN A | Endothelin receptor | Endothelin-1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48256.91
Organism:RAT
Description:ENDOTHELIN A EDNRA RAT::P26684
Residue:426
Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105011
n/a
NameBDBM50105011
Synonyms:CHEMBL368796 | sodium salt of 4-tert-Butyl-N-{6-[2-(5-methoxy-pyrimidin-2-yloxy)-ethoxy]-5-p-tolyl-pyrimidin-4-yl}-benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C28H30N5O5S
Mol. Mass.548.634
SMILESCOc1cnc(OCCOc2ncnc([N-]S(=O)(=O)c3ccc(cc3)C(C)(C)C)c2-c2ccc(C)cc2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: