Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSelectin E
LigandBDBM50105180
Substrate/Competitorn/a
Meas. Tech.ChEMBL_199699
IC50 7±n/a nM
Citation Zhu GDArendsen DLGunawardana IWBoyd SAStewart AOFry DGCool BLKifle LSchaefer VMeuth JMarsh KCKempf-Grote AJKilgannon PGallatin WMOkasinski GF Selective inhibition of ICAM-1 and E-selectin expression in human endothelial cells. 2. Aryl modifications of 4-(aryloxy)thieno[2,3-c]pyridines with fine-tuning at C-2 carbamides. J Med Chem 44:3469-87 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Selectin E
Name:Selectin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66642.96
Organism:Homo sapiens (Human)
Description:ChEMBL_1438995
Residue:610
Sequence:
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105180
n/a
NameBDBM50105180
Synonyms:4-(4-Bromo-phenoxy)-thieno[2,3-c]pyridine-2-carboxylic acid methylamide | CHEMBL326271
TypeSmall organic molecule
Emp. Form.C15H11BrN2O2S
Mol. Mass.363.229
SMILESCNC(=O)c1cc2c(Oc3ccc(Br)cc3)cncc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: