Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50105417
Substrate/Competitorn/a
Meas. Tech.ChEBML_124429
IC50 30±n/a nM
Citation Ling LUrichuk LJSloley BDCoutts RTBaker GBShan JJPang PK Synthesis of N-propargylphenelzine and analogues as neuroprotective agents. Bioorg Med Chem Lett 11:2715-7 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | Amine oxidase [flavin-containing] A | Monoamine Oxidase Type A (MAO-A) | Monoamine oxidase A (MAO-A) | Monoamine oxidase A (rMAO-A) | Monoamine oxidase type A (MAOA)
Type:Enzyme
Mol. Mass.:59515.21
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:526
Sequence:
MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKL
SSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIMGFILARKADR
QAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVEEPESKD
VPAIEITHTFLERNLPSVPGLLKITGVSTSVALLCFVLYKIKKLPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105417
n/a
NameBDBM50105417
Synonyms:CHEMBL1089 | Nardil | PHENELZINE | Phenethyl-hydrazine
TypeSmall organic molecule
Emp. Form.C8H12N2
Mol. Mass.136.1943
SMILESNNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: