Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTelomerase reverse transcriptase
LigandBDBM24709
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210226
IC50 8200±n/a nM
Citation West CFrancis RFriedman SH Small molecule/nucleic acid affinity chromatography: application for the identification of telomerase inhibitors which target its key RNA/DNA heteroduplex. Bioorg Med Chem Lett 11:2727-30 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Telomerase reverse transcriptase
Name:Telomerase reverse transcriptase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:127099.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1447029
Residue:1132
Sequence:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24709
n/a
NameBDBM24709
Synonyms:6,9-Diamino-2-Ethoxyacridine | 7-ethoxyacridine-3,9-diamine | CHEMBL94007
TypeSmall organic molecule
Emp. Form.C15H15N3O
Mol. Mass.253.2991
SMILESCCOc1ccc2nc3cc(N)ccc3c(N)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: