Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTelomerase reverse transcriptase
LigandBDBM50105462
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210226
IC50 12200±n/a nM
Citation West CFrancis RFriedman SH Small molecule/nucleic acid affinity chromatography: application for the identification of telomerase inhibitors which target its key RNA/DNA heteroduplex. Bioorg Med Chem Lett 11:2727-30 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Telomerase reverse transcriptase
Name:Telomerase reverse transcriptase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:127099.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1447029
Residue:1132
Sequence:
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105462
n/a
NameBDBM50105462
Synonyms:CHEMBL81880 | N,N,N',N'-Tetramethyl-acridine-3,6-diamine
TypeSmall organic molecule
Emp. Form.C17H19N3
Mol. Mass.265.3529
SMILESCN(C)c1ccc2cc3ccc(cc3nc2c1)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: