Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman rhinovirus A protease
LigandBDBM11318
Substrate/Competitorn/a
Meas. Tech.ChEBML_160894
IC50>150000±n/a nM
Citation Singh SBGraham PLReamer RACordingley MG Discovery, total synthesis, HRV 3C-protease inhibitory activity, and structure-activity relationships of 2-methoxystypandrone and its analogues. Bioorg Med Chem Lett 11:3143-6 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human rhinovirus A protease
Name:Human rhinovirus A protease
Synonyms:Human rhinovirus B 3A protease
Type:PROTEIN
Mol. Mass.:44361.04
Organism:Human rhinovirus B
Description:ChEMBL_158953
Residue:401
Sequence:
AFRPCNVNTKIGNAKCCPFVCGKAVTFKDRSTCSTYNLSSSLHHILEEDKRRRQVVDVMS
AIFQGPISLDAPPPPAIADLLQSVRTPRVIKYCQIIMGHPAECQVERDLNIANSIIAIIA
NIISIAGIIFVIYKLFCSLQGPYSGEPKPKTKVPERRVVAQGPEEEFGRSILKNNTCVIT
TGNGKFTGLGIHDRILIIPTHADPGREVQVNGVHTKVLDSYDLYNRDGVKLEITVIQLDR
NEKFRDIRKYIPETEDDYPECNLALSANQDEPTIIKVGDVVSYGNILLSGNQTARMLKYN
YPTKSGYCGGVLYKIGQILGIHVGGNGRDGFSAMLLRSYFTGQIKVNKHATECGLPDIQT
IHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLEVNFKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
n/a
NameBDBM11318
Synonyms:1,3,8-trihydroxy-6-methyl-9,10-dihydroanthracene-9,10-dione | 1,3,8-trihydroxy-6-methylanthra-9,10-quinone | CHEMBL289277 | Emodin
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESCc1cc(O)c2C(=O)c3c(O)cc(O)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: