Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50107097
Substrate/Competitorn/a
Meas. Tech.ChEBML_88617
IC50 1300±n/a nM
Citation Dupont RJeanson LMouscadet JFCotelle P Synthesis and HIV-1 integrase inhibitory activities of catechol and bis-catechol derivatives. Bioorg Med Chem Lett 11:3175-8 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107097
n/a
NameBDBM50107097
Synonyms:17-oxatetracyclo[7.7.1.02,7.010,15]heptadeca-2,4,6,10(15),11,13-hexaene-4,5,12,13-tetraol | CHEMBL106446
TypeSmall organic molecule
Emp. Form.C16H14O5
Mol. Mass.286.2794
SMILESOc1cc2CC3OC(Cc4cc(O)c(O)cc34)c2cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: