Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin receptor ET-A
LigandBDBM50104992
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65801
IC50 0.051000±n/a nM
Citation Morimoto HShimadzu HHosaka TKawase YYasuda KKikkawa KYamauchi-Kohno RYamada K Modifications and structure-activity relationships at the 2-position of 4-sulfonamidopyrimidine derivatives as potent endothelin antagonists. Bioorg Med Chem Lett 12:81-4 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin receptor ET-A
Name:Endothelin receptor ET-A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48707.29
Organism:Sus scrofa
Description:ChEMBL_65803
Residue:427
Sequence:
METFCFRVSFWVALLGCVISDNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERS
SHKDSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104992
n/a
NameBDBM50104992
Synonyms:CHEMBL114700 | N-[6-[2-(5-Bromo-pyrimidin-2-yloxy)-ethoxy]-5-(3-methoxy-phenoxy)-pyrimidin-4-yl]-4-tert-butyl-benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C27H28BrN5O6S
Mol. Mass.630.51
SMILESCOc1cccc(Oc2c(NS(=O)(=O)c3ccc(cc3)C(C)(C)C)ncnc2OCCOc2ncc(Br)cn2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: