Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50109386 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201564 |
---|
Ki | 5.9±n/a nM |
---|
Citation | Maeda, DY; Williams, W; Kim, WE; Thatcher, LN; Bowen, WD; Coop, A N-arylalkylpiperidines as high-affinity sigma-1 and sigma-2 receptor ligands: phenylpropylamines as potential leads for selective sigma-2 agents. Bioorg Med Chem Lett12:497-500 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50109386 |
---|
n/a |
---|
Name | BDBM50109386 |
Synonyms: | 2-Phenethyl-1,2,3,4-tetrahydro-isoquinoline | CHEMBL146238 |
Type | Small organic molecule |
Emp. Form. | C17H19N |
Mol. Mass. | 237.3395 |
SMILES | C(Cc1ccccc1)N1CCc2ccccc2C1 |
Structure |
|