| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50109389 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201564 |
|---|
| Ki | 89±n/a nM |
|---|
| Citation |  Maeda, DY; Williams, W; Kim, WE; Thatcher, LN; Bowen, WD; Coop, A N-arylalkylpiperidines as high-affinity sigma-1 and sigma-2 receptor ligands: phenylpropylamines as potential leads for selective sigma-2 agents. Bioorg Med Chem Lett12:497-500 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50109389 |
|---|
| n/a |
|---|
| Name | BDBM50109389 |
|---|
| Synonyms: | 1-Phenethyl-piperidine | 1-phenethylpiperidine | CHEMBL75228 | N-(2-phenylethyl)piperidine | N-phenethylpiperidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H19N |
|---|
| Mol. Mass. | 189.2967 |
|---|
| SMILES | C(Cc1ccccc1)N1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
