| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50109706 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159447 (CHEMBL766793) |
|---|
| IC50 | 0.600±n/a nM |
|---|
| Citation |  Cheng, Y; Rano, TA; Huening, TT; Zhang, F; Lu, Z; Schleif, WA; Gabryelski, L; Olsen, DB; Stahlhut, M; Kuo, LC; Lin, JH; Xu, X; Jin, L; Olah, TV; McLoughlin, DA; King, RC; Chapman, KT; Tata, JR A combinatorial library of indinavir analogues and its in vitro and in vivo studies. Bioorg Med Chem Lett12:529-32 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50109706 |
|---|
| n/a |
|---|
| Name | BDBM50109706 |
|---|
| Synonyms: | (S)-1-[(2S,4R)-2-Hydroxy-4-((R)-(R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-4-[5-(2-methyl-5-trifluoromethyl-2H-pyrazol-3-yl)-thiophen-2-ylmethyl]-piperazine-2-carboxylic acid tert-butylamide | CHEMBL149166 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H49F3N6O4S |
|---|
| Mol. Mass. | 766.915 |
|---|
| SMILES | Cn1nc(cc1-c1ccc(CN2CCN(C[C@@H](O)C[C@@H](Cc3ccccc3)C(=O)NC3[C@H](O)Cc4ccccc34)[C@@H](C2)C(=O)NC(C)(C)C)s1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
