Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM50110300
Substrate/Competitorn/a
Meas. Tech.ChEMBL_83468
Kd 10±n/a nM
Citation Apelt JLigneau XPertz HHArrang JMGanellin CRSchwartz JCSchunack WStark H Development of a new class of nonimidazole histamine H(3) receptor ligands with combined inhibitory histamine N-methyltransferase activity. J Med Chem 45:1128-41 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
HRH3
Name:Histamine H3 receptor
Synonyms:HISTAMINE H3 | Histamine H3 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48753.61
Organism:GUINEA PIG
Description:HISTAMINE H3 HRH3 GUINEA PIG::Q9JI35
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF
VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT
SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG
GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE
AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110300
n/a
NameBDBM50110300
Synonyms:CHEMBL15056 | N-(4-(3-(piperidin-1-yl)propoxy)phenethyl)-5,6,7,8-tetrahydroacridin-9-amine | {2-[4-(3-Piperidin-1-yl-propoxy)-phenyl]-ethyl}-(1,2,3,4-tetrahydro-acridin-9-yl)-amine; Oxalic acid
TypeSmall organic molecule
Emp. Form.C29H37N3O
Mol. Mass.443.6236
SMILESC(COc1ccc(CCNc2c3CCCCc3nc3ccccc23)cc1)CN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: