Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50110792
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195083
IC50>200000±n/a nM
Citation Khandazhinskaya ALShirokova EASkoblov YSVictorova LSGoryunova LYBeabealashvilli RSPronyaeva TRFedyuk NVZolin VVPokrovsky AGKukhanova MK Carbocyclic dinucleoside polyphosphonates: interaction with HIV reverse transcriptase and antiviral activity. J Med Chem 45:1284-91 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50110792
n/a
NameBDBM50110792
Synonyms:CHEMBL24006 | NA2 | P,P'-Bis {[4-(ade nine-9-yl)cyclopent-2-enyl]oxy-methylphosphonyl}dibromodiphosphonate
TypeSmall organic molecule
Emp. Form.C23H28Br2N10O12P4
Mol. Mass.920.231
SMILESNc1ncnc2n(cnc12)C1CC(OCP(O)(=O)OP(O)(=O)C(Br)(Br)P(O)(=O)OP(O)(=O)COC2CC(C=C2)n2cnc3c(N)ncnc23)C=C1 |c:39,54|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: