| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dioxygenase |
|---|
| Ligand | BDBM50111619 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_100830 (CHEMBL709762) |
|---|
| IC50 | 22000±n/a nM |
|---|
| Citation |  Han, S; Inoue, H; Terada, T; Kamoda, S; Saburi, Y; Sekimata, K; Saito, T; Kobayashi, M; Shinozaki, K; Yoshida, S; Asami, T Design and synthesis of lignostilbene-alpha,beta-dioxygenase inhibitors. Bioorg Med Chem Lett12:1139-42 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dioxygenase |
|---|
| Name: | Dioxygenase |
|---|
| Synonyms: | Lignostilbene alpha, beta-dioxygenase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14181.67 |
|---|
| Organism: | Pseudomonas paucimobilis |
|---|
| Description: | ChEMBL_19606 |
|---|
| Residue: | 128 |
|---|
| Sequence: | MSFPATPDYTGLNKPVGQEVSIKGLKASEGTIPADVRGAFFRAVPDPQFPPFFHPDTALS
DDGMISRVLFNADGTVDYDIRYVQTPRWKAERAAGKRLFGRYRNPYTNDPSAFDLEGTVS
NTTPVWHA
|
|
|
|---|
| BDBM50111619 |
|---|
| n/a |
|---|
| Name | BDBM50111619 |
|---|
| Synonyms: | 1,2-diphenyl-(Z)-1-propene | CHEMBL14933 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14 |
|---|
| Mol. Mass. | 194.2717 |
|---|
| SMILES | C\C(=C\c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
