Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50111625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201410
Ki 2±n/a nM
Citation Mouithys-Mickalad APoupaert JHSpampinato SLesieur D Synthesis and pharmacological evaluation of 6-piperidino- and 6-piperazinoalkyl-2(3H)-benzothiazolones as mixed sigma/5-HT(1A) ligands. Bioorg Med Chem Lett 12:1149-52 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111625
n/a
NameBDBM50111625
Synonyms:6-[4-(4-Benzyl-piperazin-1-yl)-butyl]-3-methyl-3H-benzothiazol-2-one | CHEMBL15941
TypeSmall organic molecule
Emp. Form.C23H29N3OS
Mol. Mass.395.561
SMILESCn1c2ccc(CCCCN3CCN(Cc4ccccc4)CC3)cc2sc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: