Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50111729
Substrate/Competitorn/a
Meas. Tech.ChEBML_212857
Ki 4.4±n/a nM
Citation Reiner JESiev DVAraldi GLCui JJHo JZReddy KMMamedova LVu PHLee KSMinami NKGibson TSAnderson SMBradbury AENolan TGSemple JE Non-covalent thrombin inhibitors featuring P(3)-heterocycles with P(1)-monocyclic arginine surrogates. Bioorg Med Chem Lett 12:1203-8 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111729
n/a
NameBDBM50111729
Synonyms:CHEMBL277695 | N-(5-Carbamimidoyl-thiophen-2-ylmethyl)-2-(6-methyl-2-oxo-3-phenethylamino-2H-pyrazin-1-yl)-acetamide
TypeSmall organic molecule
Emp. Form.C21H24N6O2S
Mol. Mass.424.519
SMILESCc1cnc(NCCc2ccccc2)c(=O)n1CC(=O)NCc1ccc(s1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: