Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTubulin
LigandBDBM50112256
Substrate/Competitorn/a
Meas. Tech.ChEMBL_225980
IC50 170±n/a nM
Citation Wipf PReeves JTBalachandran RDay BW Synthesis and biological evaluation of structurally highly modified analogues of the antimitotic natural product curacin A. J Med Chem 45:1901-17 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tubulin
Name:Tubulin
Synonyms:Tubulin alpha chain | Tubulin alpha-1A chain
Type:Protein
Mol. Mass.:50049.25
Organism:Sus scrofa (Pig)
Description:P02550
Residue:451
Sequence:
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112256
n/a
NameBDBM50112256
Synonyms:3,4,5-Trimethoxy-benzaldehyde O-(8-hydroxy-5-methyl-8-thiophen-2-yl-octa-2,4-dienyl)-oxime | CHEMBL56812
TypeSmall organic molecule
Emp. Form.C23H29NO5S
Mol. Mass.431.545
SMILESCOc1cc(\C=N/OC\C=C\C=C(/C)CCC(O)c2cccs2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: