| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Farnesyl pyrophosphate synthase |
|---|
| Ligand | BDBM25313 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_69350 (CHEMBL677586) |
|---|
| IC50 | 50±n/a nM |
|---|
| Citation |  Szabo, CM; Matsumura, Y; Fukura, S; Martin, MB; Sanders, JM; Sengupta, S; Cieslak, JA; Loftus, TC; Lea, CR; Lee, HJ; Koohang, A; Coates, RM; Sagami, H; Oldfield, E Inhibition of geranylgeranyl diphosphate synthase by bisphosphonates and diphosphates: a potential route to new bone antiresorption and antiparasitic agents. J Med Chem45:2185-96 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Farnesyl pyrophosphate synthase |
|---|
| Name: | Farnesyl pyrophosphate synthase |
|---|
| Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48272.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14324 |
|---|
| Residue: | 419 |
|---|
| Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
|---|
| BDBM25313 |
|---|
| n/a |
|---|
| Name | BDBM25313 |
|---|
| Synonyms: | (4-amino-1-hydroxy-1-phosphonobutyl)phosphonic acid | Alendronate | CHEMBL870 | bisphosphonate, 65 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C4H13NO7P2 |
|---|
| Mol. Mass. | 249.096 |
|---|
| SMILES | NCCCC(O)(P(O)(O)=O)P(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
