Reaction Details |
| Report a problem with these data |
Target | Farnesyl pyrophosphate synthase |
---|
Ligand | BDBM12576 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_69350 (CHEMBL677586) |
---|
IC50 | 10±n/a nM |
---|
Citation | Szabo, CM; Matsumura, Y; Fukura, S; Martin, MB; Sanders, JM; Sengupta, S; Cieslak, JA; Loftus, TC; Lea, CR; Lee, HJ; Koohang, A; Coates, RM; Sagami, H; Oldfield, E Inhibition of geranylgeranyl diphosphate synthase by bisphosphonates and diphosphates: a potential route to new bone antiresorption and antiparasitic agents. J Med Chem45:2185-96 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Farnesyl pyrophosphate synthase |
---|
Name: | Farnesyl pyrophosphate synthase |
Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
Type: | Enzyme |
Mol. Mass.: | 48272.89 |
Organism: | Homo sapiens (Human) |
Description: | P14324 |
Residue: | 419 |
Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
BDBM12576 |
---|
n/a |
---|
Name | BDBM12576 |
Synonyms: | Bisphosphonate 1 | CHEMBL923 | JMC515594 Compound 64 | RIS | Risdronate | US11279719, Example Risedronic acid RIS | [1-hydroxy-1-phosphono-2-(pyridin-3-yl)ethyl]phosphonic acid |
Type | Small organic molecule |
Emp. Form. | C7H11NO7P2 |
Mol. Mass. | 283.1123 |
SMILES | OC(Cc1cccnc1)(P(O)(O)=O)P(O)(O)=O |
Structure |
|