Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50113680 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_50316 (CHEMBL661621) |
---|
IC50 | 300000±n/a nM |
---|
Citation | Naumann, T; Matter, H Structural classification of protein kinases using 3D molecular interaction field analysis of their ligand binding sites: target family landscapes. J Med Chem45:2366-78 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50113680 |
---|
n/a |
---|
Name | BDBM50113680 |
Synonyms: | (R)-2-(6-(3-chlorophenylamino)-9-isopropyl-9H-purin-2-ylamino)butan-1-ol | 2-[6-(3-Chloro-phenylamino)-9-isopropyl-9H-purin-2-ylamino]-butan-1-ol | CHEMBL306783 | cid_16746116 |
Type | Small organic molecule |
Emp. Form. | C18H23ClN6O |
Mol. Mass. | 374.868 |
SMILES | CC[C@H](CO)Nc1nc(Nc2cccc(Cl)c2)c2ncn(C(C)C)c2n1 |r| |
Structure |
|