Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50113787
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212873
Ki 89±n/a nM
Citation Danilewicz JCAbel SMBrown ADFish PVHawkeswood EHolland SJJames KMcElroy ABOverington JPowling MJRance DJ Design of selective thrombin inhibitors based on the (R)-Phe-Pro-Arg sequence. J Med Chem 45:2432-53 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50113787
n/a
NameBDBM50113787
Synonyms:CHEMBL81056 | S-(2-{2-[2-(4-Carbamimidoyl-phenoxy)-ethyl]-piperidin-1-yl}-1-cyclohexylmethyl-2-oxo-ethylamino)-acetic acid
TypeSmall organic molecule
Emp. Form.C25H38N4O4
Mol. Mass.458.5936
SMILESNC(=N)c1ccc(OCC[C@@H]2CCCCN2C(=O)[C@@H](CC2CCCCC2)NCC(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: