Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM50114239
Substrate/Competitorn/a
Meas. Tech.ChEBML_124642
IC50 45±n/a nM
Citation Dumas JHatoum-Mokdad HSibley RNSmith RAScott WJKhire ULee WWood JWolanin DCooley JBankston DRedman AMSchoenleber RCaringal YGunn DRomero ROsterhout MPaulsen HHousley TJWilhelm SMPirro JChien DSRanges GEShrikhande AMuzsi ABortolon EWakefield JGianpaolo Ostravage CBhargava AChau T Synthesis and pharmacological characterization of a potent, orally active p38 kinase inhibitor. Bioorg Med Chem Lett 12:1559-62 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 14
Name:Mitogen-activated protein kinase 14
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP Kinase p38 alpha | MAP kinase MXI2 | MAP kinase p38 | MAX-interacting protein 2 | Mitogen-activated protein kinase (MAP) p38 alpha | Mitogen-activated protein kinase (Map p38 alpha) | Mitogen-activated protein kinase 14 (MAP kinase p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14 p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKa) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKÿ±) | Mitogen-activated protein kinase 14 (p38 MAPKa) | Mitogen-activated protein kinase 14 (p38 alpha) | Mitogen-activated protein kinase 14, activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha (p38 MAPKa) | SAPK2A | p38-alpha
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50114239
n/a
NameBDBM50114239
Synonyms:CHEMBL40166 | N-(4-{4-[3-(5-tert-Butyl-2-methyl-2H-pyrazol-3-yl)-ureido]-phenoxy}-phenyl)-3-methyl-butyramide
TypeSmall organic molecule
Emp. Form.C26H33N5O3
Mol. Mass.463.5719
SMILESCC(C)CC(=O)Nc1ccc(Oc2ccc(NC(=O)Nc3cc(nn3C)C(C)(C)C)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: