Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50114673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46980
Ki 228.0±n/a nM
Citation Francisco MESeltzman HHGilliam AFMitchell RARider SLPertwee RGStevenson LAThomas BF Synthesis and structure-activity relationships of amide and hydrazide analogues of the cannabinoid CB(1) receptor antagonist N-(piperidinyl)- 5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (SR141716). J Med Chem 45:2708-19 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50114673
n/a
NameBDBM50114673
Synonyms:5-(4-Chloro-phenyl)-1-(2,4-dichloro-phenyl)-4-methyl-1H-pyrazole-3-carboxylic acid cyclohexylamide | 5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methyl-1H-pyrazole-3-(N-cyclohexylcarboxamide) | CHEMBL15874
TypeSmall organic molecule
Emp. Form.C23H22Cl3N3O
Mol. Mass.462.799
SMILESCc1c(nn(c1-c1ccc(Cl)cc1)-c1ccc(Cl)cc1Cl)C(=O)NC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: