| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Ligand | BDBM50115295 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_123985 (CHEMBL732663) |
|---|
| IC50 | >30000±n/a nM |
|---|
| Citation |  Matsuno, K; Ichimura, M; Nakajima, T; Tahara, K; Fujiwara, S; Kase, H; Ushiki, J; Giese, NA; Pandey, A; Scarborough, RM; Lokker, NA; Yu, JC; Irie, J; Tsukuda, E; Ide, S; Oda, S; Nomoto, Y Potent and selective inhibitors of platelet-derived growth factor receptor phosphorylation. 1. Synthesis, structure-activity relationship, and biological effects of a new class of quinazoline derivatives. J Med Chem45:3057-66 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Name: | Dual specificity mitogen-activated protein kinase kinase 3 |
|---|
| Synonyms: | Dual specificity mitogen-activated protein kinase kinase 3 | MAP kinase kinase 3 | MAP2K3 | MAPK/ERK kinase 3 | MAPK/ERK kinase 3 (MEK3) | MAPKK 3 | MEK3 | MKK3 | MP2K3_HUMAN | PRKMK3 | SKK2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39321.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 347 |
|---|
| Sequence: | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
|
|
|
|---|
| BDBM50115295 |
|---|
| n/a |
|---|
| Name | BDBM50115295 |
|---|
| Synonyms: | 4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-nitro-phenyl)-amide | 4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-nitro-phenyl)-amide(KN1022) | CHEMBL99743 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22N6O5 |
|---|
| Mol. Mass. | 438.4366 |
|---|
| SMILES | COc1cc2ncnc(N3CCN(CC3)C(=O)Nc3ccc(cc3)[N+]([O-])=O)c2cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
