Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity mitogen-activated protein kinase kinase 3
LigandBDBM50115298
Substrate/Competitorn/a
Meas. Tech.ChEMBL_123985
IC50>30000±n/a nM
Citation Matsuno KIchimura MNakajima TTahara KFujiwara SKase HUshiki JGiese NAPandey AScarborough RMLokker NAYu JCIrie JTsukuda EIde SOda SNomoto Y Potent and selective inhibitors of platelet-derived growth factor receptor phosphorylation. 1. Synthesis, structure-activity relationship, and biological effects of a new class of quinazoline derivatives. J Med Chem 45:3057-66 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual specificity mitogen-activated protein kinase kinase 3
Name:Dual specificity mitogen-activated protein kinase kinase 3
Synonyms:Dual specificity mitogen-activated protein kinase kinase 3 | MAP kinase kinase 3 | MAPK/ERK kinase 3 | MAPK/ERK kinase 3 (MEK3) | MAPKK 3
Type:Protein
Mol. Mass.:39321.50
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115298
n/a
NameBDBM50115298
Synonyms:4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-bromo-phenyl)-amide | CHEMBL323336
TypeSmall organic molecule
Emp. Form.C21H22BrN5O3
Mol. Mass.472.335
SMILESCOc1cc2ncnc(N3CCN(CC3)C(=O)Nc3ccc(Br)cc3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: