Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMacrophage colony-stimulating factor 1 receptor
LigandBDBM50115298
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47911
IC50>30000±n/a nM
Citation Matsuno KIchimura MNakajima TTahara KFujiwara SKase HUshiki JGiese NAPandey AScarborough RMLokker NAYu JCIrie JTsukuda EIde SOda SNomoto Y Potent and selective inhibitors of platelet-derived growth factor receptor phosphorylation. 1. Synthesis, structure-activity relationship, and biological effects of a new class of quinazoline derivatives. J Med Chem 45:3057-66 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Macrophage colony-stimulating factor 1 receptor
Name:Macrophage colony-stimulating factor 1 receptor
Synonyms:CSF1R | Fms proto-oncogene | Macrophage colony stimulating factor receptor | Macrophage colony-stimulating factor 1 receptor (CSF1R) | Macrophage colony-stimulating factor 1 receptor (FMS) | Macrophage colony-stimulating factor 1 receptor (c-FMS) | Macrophage colony-stimulating factor 1 receptor (cFMS) | Proto-oncogene c-Fms | Tyrosine Kinase CSF1-R | c-fms
Type:Tyrosine-protein kinase
Mol. Mass.:107979.48
Organism:Homo sapiens (Human)
Description:n/a
Residue:972
Sequence:
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115298
n/a
NameBDBM50115298
Synonyms:4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-bromo-phenyl)-amide | CHEMBL323336
TypeSmall organic molecule
Emp. Form.C21H22BrN5O3
Mol. Mass.472.335
SMILESCOc1cc2ncnc(N3CCN(CC3)C(=O)Nc3ccc(Br)cc3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: