Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM50115301
Substrate/Competitorn/a
Meas. Tech.ChEMBL_202772
IC50>30000±n/a nM
Citation Matsuno KIchimura MNakajima TTahara KFujiwara SKase HUshiki JGiese NAPandey AScarborough RMLokker NAYu JCIrie JTsukuda EIde SOda SNomoto Y Potent and selective inhibitors of platelet-derived growth factor receptor phosphorylation. 1. Synthesis, structure-activity relationship, and biological effects of a new class of quinazoline derivatives. J Med Chem 45:3057-66 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115301
n/a
NameBDBM50115301
Synonyms:4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-phenoxy-phenyl)-amide | CHEMBL102346
TypeSmall organic molecule
Emp. Form.C27H27N5O4
Mol. Mass.485.5344
SMILESCOc1cc2ncnc(N3CCN(CC3)C(=O)Nc3ccc(Oc4ccccc4)cc3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: