Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase p38
LigandBDBM50116034
Substrate/Competitorn/a
Meas. Tech.ChEBML_124498
IC50 470±n/a nM
Citation Revesz LDi Padova FEBuhl TFeifel RGram HHiestand PManning UWolf RZimmerlin AG SAR of 2,6-diamino-3,5-difluoropyridinyl substituted heterocycles as novel p38MAP kinase inhibitors. Bioorg Med Chem Lett 12:2109-12 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MAP kinase p38
Name:MAP kinase p38
Synonyms:CRK1 | MAP Kinase p38 alpha | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha
Type:Enzyme
Mol. Mass.:41281.22
Organism:Mus musculus (mouse)
Description:The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography.
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116034
n/a
NameBDBM50116034
Synonyms:3,5-Difluoro-4-[5-pyridin-4-yl-4-(3-trifluoromethyl-phenyl)-1H-imidazol-2-yl]-pyridine-2,6-diamine | 3,5-difluoro-4-(5-(pyridin-4-yl)-4-(3-(trifluoromethyl)phenyl)-1H-imidazol-2-yl)pyridine-2,6-diamine | CHEMBL304416
TypeSmall organic molecule
Emp. Form.C20H13F5N6
Mol. Mass.432.3494
SMILESNc1nc(N)c(F)c(-c2nc(c([nH]2)-c2cccc(c2)C(F)(F)F)-c2ccncc2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: