Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGranzyme B
LigandBDBM50116258
Substrate/Competitorn/a
Meas. Tech.ChEBML_72172
Ki 133±n/a nM
Citation Willoughby CABull HGGarcia-Calvo MJiang JChapman KTThornberry NA Discovery of potent, selective human granzyme B inhibitors that inhibit CTL mediated apoptosis. Bioorg Med Chem Lett 12:2197-200 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Granzyme B
Name:Granzyme B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:27735.56
Organism:Homo sapiens (Human)
Description:ChEMBL_469245
Residue:247
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116258
n/a
NameBDBM50116258
Synonyms:(S)-3-{2-[3-((2S,3S)-2-Acetylamino-3-methyl-pentanoylamino)-2-oxo-2H-pyridin-1-yl]-acetylamino}-4-oxo-butyric acid | CHEMBL69482
TypeSmall organic molecule
Emp. Form.C19H26N4O7
Mol. Mass.422.4323
SMILESCC[C@H](C)[C@H](NC(C)=O)C(=O)Nc1cccn(CC(=O)N[C@@H](CC(O)=O)C=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: