Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Lck
LigandBDBM50116399
Substrate/Competitorn/a
Meas. Tech.ChEMBL_221318
IC50 27±n/a nM
Citation Snow RJCardozo MGMorwick TMBusacca CADong YEckner RJJacober SJakes SKapadia SLukas SPanzenbeck MPeet GWPeterson JDProkopowicz ASSellati RTolbert RMTschantz MAMoss N Discovery of 2-phenylamino-imidazo[4,5-h]isoquinolin-9-ones: a new class of inhibitors of lck kinase. J Med Chem 45:3394-405 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Lck
Name:Tyrosine-protein kinase Lck
Synonyms:2.7.10.2 | LCK | LSK | Leukocyte C-terminal Src kinase | Lymphocyte cell-specific protein-tyrosine kinase | Lymphocyte-specific protein tyrosine kinase | P56-LCK | Protein YT16 | Proto-oncogene Lck | Proto-oncogene tyrosine-protein kinase LCK | SRC | T cell-specific protein-tyrosine kinase
Type:n/a
Mol. Mass.:57987.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:509
Sequence:
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116399
n/a
NameBDBM50116399
Synonyms:2-(2-Chloro-6-methyl-phenylamino)-6,7-dimethyl-1,8-dihydro-imidazo[4,5-h]isoquinolin-9-one | CHEMBL117267
TypeSmall organic molecule
Emp. Form.C19H17ClN4O
Mol. Mass.352.817
SMILESCc1cccc(Cl)c1Nc1nc2c(ccc3c(C)c(C)[nH]c(=O)c23)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: