Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance-K receptor
LigandBDBM50116723
Substrate/Competitorn/a
Meas. Tech.ChEBML_209036
Ki 1±n/a nM
Citation Reichard GAGrice CAShih NYSpitler JMajmundar SWang SDPaliwal SAnthes JCPiwinski JJ Preparation of oxime dual NK(1)/NK(2) antagonists with reduced NK(3) affinity. Bioorg Med Chem Lett 12:2355-8 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Substance-K receptor
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2)
Type:Protein
Mol. Mass.:44455.78
Organism:Homo sapiens (Human)
Description:P21452
Residue:398
Sequence:
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116723
n/a
NameBDBM50116723
Synonyms:3,5-Dichloro-N-{(R)-3-(3,4-dichloro-phenyl)-2-[(Z)-methoxyimino]-5-[4-(2-oxo-2,3-dihydro-benzoimidazol-1-yl)-piperidin-1-yl]-pentyl}-N-methyl-benzamide | CHEMBL75422
TypeSmall organic molecule
Emp. Form.C32H33Cl4N5O3
Mol. Mass.677.448
SMILESCO\N=C(/CN(C)C(=O)c1cc(Cl)cc(Cl)c1)[C@H](CCN1CCC(CC1)n1c2ccccc2[nH]c1=O)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: