Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50056456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46465
Ki>1500±n/a nM
Citation Barnett-Norris JHurst DPLynch DLGuarnieri FMakriyannis AReggio PH Conformational memories and the endocannabinoid binding site at the cannabinoid CB1 receptor. J Med Chem 45:3649-59 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056456
n/a
NameBDBM50056456
Synonyms:(11Z,14Z)-Icosa-11,14-dienoic acid (2-hydroxy-ethyl)-amide | CHEMBL121316 | Icosa-11,14-dienoic acid (2-hydroxy-ethyl)-amide
TypeSmall organic molecule
Emp. Form.C22H41NO2
Mol. Mass.351.5664
SMILESCCCCC\C=C/C\C=C/CCCCCCCCCC(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: