Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM22988
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47008
Ki 360±n/a nM
Citation van der Stelt Mvan Kuik JABari Mvan Zadelhoff GLeeflang BRVeldink GAFinazzi-Agrò AVliegenthart JFMaccarrone M Oxygenated metabolites of anandamide and 2-arachidonoylglycerol: conformational analysis and interaction with cannabinoid receptors, membrane transporter, and fatty acid amide hydrolase. J Med Chem 45:3709-20 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22988
n/a
NameBDBM22988
Synonyms:(5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)icosa-5,8,11,14-tetraenamide | AEA | ANANDAMIDE | Arachidonoyl ethanolamide | Arachidonoyl ethanolamide (AEA) | Arachidonoylethanolamide (AEA) | Arachidonylethanolamide | CHEMBL15848 | [14C]Anandamide | [3H]Anandamide
Typeradiolabeled substrate
Emp. Form.C22H37NO2
Mol. Mass.347.5347
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: