Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM50118434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104940
Ki>10000±n/a nM
Citation Fukatsu KUchikawa OKawada MYamano TYamashita MKato KHirai KHinuma SMiyamoto MOhkawa S Synthesis of a novel series of benzocycloalkene derivatives as melatonin receptor agonists. J Med Chem 45:4212-21 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118434
n/a
NameBDBM50118434
Synonyms:2,2,2-Trifluoro-N-[2-(3-methoxy-6,7,8,9-tetrahydro-5H-benzocyclohepten-5-yl)-ethyl]-acetamide | CHEMBL132463
TypeSmall organic molecule
Emp. Form.C16H20F3NO2
Mol. Mass.315.3307
SMILESCOc1ccc2CCCCC(CCNC(=O)C(F)(F)F)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: