Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50118470
Substrate/Competitorn/a
Meas. Tech.ChEMBL_105275
Ki 0.045±n/a nM
Citation Uchikawa OFukatsu KTokunoh RKawada MMatsumoto KImai YHinuma SKato KNishikawa HHirai KMiyamoto MOhkawa S Synthesis of a novel series of tricyclic indan derivatives as melatonin receptor agonists. J Med Chem 45:4222-39 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118470
n/a
NameBDBM50118470
Synonyms:CHEMBL1218 | N-[2-(1,6,7,8-Tetrahydro-2H-3-oxa-as-indacen-8-yl)-ethyl]-propionamide(S)-(-)-22b | RAMELTEON | Rozerem
TypeSmall organic molecule
Emp. Form.C16H21NO2
Mol. Mass.259.3434
SMILESCCC(=O)NCC[C@@H]1CCc2ccc3OCCc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: