| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50118529 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_37198 (CHEMBL650799) |
|---|
| Ki | 0.92±n/a nM |
|---|
| Citation |  Campiani, G; Ramunno, A; Fiorini, I; Nacci, V; Morelli, E; Novellino, E; Goegan, M; Mennini, T; Sullivan, S; Zisterer, DM; Williams, CD Synthesis of new molecular probes for investigation of steroid biosynthesis induced by selective interaction with peripheral type benzodiazepine receptors (PBR). J Med Chem45:4276-81 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50118529 |
|---|
| n/a |
|---|
| Name | BDBM50118529 |
|---|
| Synonyms: | Butyl-methyl-carbamic acid 5-phenyl-6-oxa-10b-aza-benzo[e]azulen-4-yl ester | CHEMBL134282 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N2O3 |
|---|
| Mol. Mass. | 388.459 |
|---|
| SMILES | CCCCN(C)C(=O)OC1=C(Oc2ccccc2-n2cccc12)c1ccccc1 |t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
