| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50118962 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159288 |
|---|
| IC50 | 0.200000±n/a nM |
|---|
| Citation |  Raghavan, S; Yang, Z; Mosley, RT; Schleif, WA; Gabryelski, L; Olsen, DB; Stahlhut, M; Kuo, LC; Emini, EA; Chapman, KT; Tata, JR Combinatorial library of indinavir analogues: replacement for the aminoindanol at P2'. Bioorg Med Chem Lett12:2855-8 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50118962 |
|---|
| n/a |
|---|
| Name | BDBM50118962 |
|---|
| Synonyms: | (R)-1-[(3R,5R)-2-Hydroxy-4-(4-hydroxy-2,6-dimethyl-benzylcarbamoyl)-5-phenyl-pentyl]-4-(1-pyrimidin-2-yl-2,3-dihydro-1H-indole-5-sulfonyl)-piperazine-2-carboxylic acid tert-butylamide | CHEMBL318114 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H53N7O6S |
|---|
| Mol. Mass. | 783.979 |
|---|
| SMILES | Cc1cc(O)cc(C)c1CNC(=O)[C@@H](C[C@@H](O)CN1CCN(C[C@@H]1C(=O)NC(C)(C)C)S(=O)(=O)c1ccc2N(CCc2c1)c1ncccn1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
