Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM50119991
Substrate/Competitorn/a
Meas. Tech.ChEBML_62964
Ki 3±n/a nM
Citation Zhao HHe XThurkauf AHoffman DKieltyka ABrodbeck RPrimus RWasley JW Indoline and piperazine containing derivatives as a novel class of mixed D(2)/D(4) receptor antagonists. Part 2: asymmetric synthesis and biological evaluation. Bioorg Med Chem Lett 12:3111-5 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50119991
n/a
NameBDBM50119991
Synonyms:2-(4-Benzo[1,3]dioxol-5-ylmethyl-piperazin-1-yl)-1-((R)-2-methyl-2,3-dihydro-indol-1-yl)-ethanone | CHEMBL322222
TypeSmall organic molecule
Emp. Form.C23H27N3O3
Mol. Mass.393.4788
SMILESC[C@@H]1Cc2ccccc2N1C(=O)CN1CCN(Cc2ccc3OCOc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: