| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50120058 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_147337 |
|---|
| Ki | 5216±n/a nM |
|---|
| Citation |  Roy, C; Li, T; Krasik, P; Gilbert, MJ; Pelletier, C; Gagnon, D; Robert, E; Ducharme, J; Storer, R; Lavallée, JF Synthesis and structure--activity relationship of novel aminotetralin derivatives with high micro selective opioid affinity. Bioorg Med Chem Lett12:3141-3 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50120058 |
|---|
| n/a |
|---|
| Name | BDBM50120058 |
|---|
| Synonyms: | 7-Amino-6-methoxy-8,8-dimethyl-5,6,7,8-tetrahydro-naphthalen-2-ol | CHEMBL106432 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H19NO2 |
|---|
| Mol. Mass. | 221.2955 |
|---|
| SMILES | CO[C@@H]1Cc2ccc(O)cc2C(C)(C)[C@@H]1N |
|---|
| Structure | 
|
|---|
Search and Browse
