Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasminogen
LigandBDBM50120225
Substrate/Competitorn/a
Meas. Tech.ChEBML_155061
IC50 0.230000±n/a nM
Citation Iwanowicz EJKimball SDLin JLau WHan WCWang TCRoberts DGSchumacher WAOgletree MLSeiler SM Retro-binding thrombin active site inhibitors: identification of an orally active inhibitor of thrombin catalytic activity. Bioorg Med Chem Lett 12:3183-6 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Plasminogen
Name:Plasminogen
Synonyms:Activation peptide | Angiostatin | Plasmin | Plasmin heavy chain A | Plasmin heavy chain A, short form | Plasmin light chain B
Type:Enzyme
Mol. Mass.:90579.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:810
Sequence:
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50120225
n/a
NameBDBM50120225
Synonyms:2-{[2-(4-Guanidino-butyrylamino)-3-(4-nitro-phenyl)-propionyl]-methyl-amino}-3-hydroxy-N-(1-phenyl-ethyl)-butyramide | CHEMBL105819
TypeSmall organic molecule
Emp. Form.C27H37N7O6
Mol. Mass.555.626
SMILESCC(O)C(N(C)C(=O)C(Cc1ccc(cc1)[N+]([O-])=O)NC(=O)CCC[N-]C(N)=[NH2+])C(=O)NC(C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: