Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50120350 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_37065 |
---|
Ki | 875±n/a nM |
---|
Citation | Pacofsky, GJ; Stafford, JA; Cox, RF; Cowan, JR; Dorsey, GF; Gonzales, SS; Kaldor, I; Koszalka, GW; Lovell, GG; McIntyre, MS; Tidwell, JH; Todd, D; Whitesell, G; Wiard, RP; Feldman, PL Relating the structure, activity, and physical properties of ultrashort-acting benzodiazepine receptor agonists. Bioorg Med Chem Lett12:3219-22 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50120350 |
---|
n/a |
---|
Name | BDBM50120350 |
Synonyms: | 3-[(S)-2-Benzylamino-7-chloro-5-(2-fluoro-phenyl)-3H-benzo[e][1,4]diazepin-3-yl]-propionic acid methyl ester | CHEMBL109694 |
Type | Small organic molecule |
Emp. Form. | C26H23ClFN3O2 |
Mol. Mass. | 463.931 |
SMILES | COC(=O)CC[C@@H]1N=C(c2ccccc2F)c2cc(Cl)ccc2N=C1NCc1ccccc1 |c:25,t:7| |
Structure |
|