Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM21363
Substrate/Competitorn/a
Meas. Tech.ChEBML_37065
Ki 2±n/a nM
Citation Pacofsky GJStafford JACox RFCowan JRDorsey GFGonzales SSKaldor IKoszalka GWLovell GGMcIntyre MSTidwell JHTodd DWhitesell GWiard RPFeldman PL Relating the structure, activity, and physical properties of ultrashort-acting benzodiazepine receptor agonists. Bioorg Med Chem Lett 12:3219-22 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21363
n/a
NameBDBM21363
Synonyms:12-chloro-9-(2-fluorophenyl)-3-methyl-2,4,8-triazatricyclo[8.4.0.0^{2,6}]tetradeca-1(10),3,5,8,11,13-hexaene | 8-chloro-6-(2-fluorophenyl)-1-methyl-4H-imidazo[1,5-a][1,4]benzodiazepine | CHEMBL655 | Dormicum | Midazolam | Ro 21-3981
TypeSmall organic molecule
Emp. Form.C18H13ClFN3
Mol. Mass.325.767
SMILESCc1ncc2CN=C(c3ccccc3F)c3cc(Cl)ccc3-n12 |t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: