| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM50120502 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_89487 |
|---|
| Ki | 0.340000±n/a nM |
|---|
| Citation |  Carpino, PA; Lefker, BA; Toler, SM; Pan, LC; Hadcock, JR; Murray, MC; Cook, ER; DiBrino, JN; DeNinno, SL; Chidsey-Frink, KL; Hada, WA; Inthavongsay, J; Lewis, SK; Mangano, FM; Mullins, MA; Nickerson, DF; Ng, O; Pirie, CM; Ragan, JA; Rose, CR; Tess, DA; Wright, AS; Yu, L; Zawistoski, MP; Pettersen, JC; DaSilva-Jardine, PA; Wilson, TC; Thompson, DD Discovery and biological characterization of capromorelin analogues with extended half-lives. Bioorg Med Chem Lett12:3279-82 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM50120502 |
|---|
| n/a |
|---|
| Name | BDBM50120502 |
|---|
| Synonyms: | 2-Amino-N-[(R)-2-(3a-benzyl-2-tert-butyl-3-oxo-2,3,3a,4,6,7-hexahydro-pyrazolo[4,3-c]pyridin-5-yl)-1-(3,4-difluoro-benzyloxymethyl)-2-oxo-ethyl]-2-methyl-propionamide | CHEMBL331801 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H39F2N5O4 |
|---|
| Mol. Mass. | 583.6693 |
|---|
| SMILES | CC(C)(C)N1N=C2CCN(CC2(Cc2ccccc2)C1=O)C(=O)[C@@H](COCc1ccc(F)c(F)c1)NC(=O)C(C)(C)N |t:5| |
|---|
| Structure | 
|
|---|
Search and Browse
