| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 2 |
|---|
| Ligand | BDBM50000130 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_70467 (CHEMBL676958) |
|---|
| IC50 | 25.2±n/a nM |
|---|
| Citation |  Murphy, PV; Pitt, N; O'Brien, A; Enright, PM; Dunne, A; Wilson, SJ; Duane, RM; O'Boyle, KM Identification of novel inhibitors of fibroblast growth factor (FGF-2) binding to heparin and endothelial cell survival from a structurally diverse carbohybrid library. Bioorg Med Chem Lett12:3287-90 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fibroblast growth factor 2 |
|---|
| Name: | Fibroblast growth factor 2 |
|---|
| Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30803.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09038 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
|---|
| BDBM50000130 |
|---|
| n/a |
|---|
| Name | BDBM50000130 |
|---|
| Synonyms: | CHEMBL320550 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H15Cl2NO8 |
|---|
| Mol. Mass. | 396.177 |
|---|
| SMILES | OC1C(O)C(NC(=O)COc2ccc(Cl)cc2Cl)OC(C1O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
