Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 2 |
---|
Ligand | BDBM50421574 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_70468 (CHEMBL676959) |
---|
IC50 | 340±n/a nM |
---|
Citation | Murphy, PV; Pitt, N; O'Brien, A; Enright, PM; Dunne, A; Wilson, SJ; Duane, RM; O'Boyle, KM Identification of novel inhibitors of fibroblast growth factor (FGF-2) binding to heparin and endothelial cell survival from a structurally diverse carbohybrid library. Bioorg Med Chem Lett12:3287-90 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 2 |
---|
Name: | Fibroblast growth factor 2 |
Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
Type: | Protein |
Mol. Mass.: | 30803.89 |
Organism: | Homo sapiens (Human) |
Description: | P09038 |
Residue: | 288 |
Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
BDBM50421574 |
---|
n/a |
---|
Name | BDBM50421574 |
Synonyms: | CHEMBL2303729 |
Type | Small organic molecule |
Emp. Form. | C12H17NO9 |
Mol. Mass. | 319.2647 |
SMILES | O[C@@H]1[C@H](O)[C@H](OCCN2C(=O)CCC2=O)O[C@H]([C@H]1O)C(O)=O |r| |
Structure |
|