Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50121041
Substrate/Competitorn/a
Meas. Tech.ChEBML_48350
IC50 0.500000±n/a nM
Citation Zhou NEKaleta JPurisima EMenard RMicetich RGSingh R 6-Acylamino-penam derivatives: synthesis and inhibition of cathepsins B, L, K, and S. Bioorg Med Chem Lett 12:3417-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121041
n/a
NameBDBM50121041
Synonyms:CHEMBL326093 | [(S)-1-((R)-4,7-Dioxo-4-(S)-oxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]hept-6-ylcarbamoyl)-2-phenyl-ethyl]-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C22H23N3O6S
Mol. Mass.457.5
SMILESO=C(N[C@@H](Cc1ccccc1)C(=O)N[C@H]1[C@H]2N(CCS2(=O)=O)C1=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: